Description
CJC-1295 No DAC + IPA is a multi-component research peptide blend containing CJC-1295 No DAC (Modified GRF 1-29) and Ipamorelin.
Because the formulation contains two chemically distinct modified peptides, the complete blend does not have one universal CAS number, molecular formula, molecular weight, or amino-acid sequence. Each component should be documented separately.
The abbreviation IPA in this product name refers to Ipamorelin. The exact amount and ratio of both components should be confirmed using the product label and applicable Certificate of Analysis.
Component 1 — CJC-1295 No DAC
Alternative Name: Modified GRF (1-29)
Common CAS Reference: 863288-34-0
Molecular Formula: C₁₅₂H₂₅₂N₄₄O₄₂
Molecular Weight: Approximately 3367.9 g/mol
Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH₂
One-Letter Representation: YADAIFTQSYRKVLAQLSARKLLQDILSR-NH₂
Length: 29 amino-acid residues
Product Type: Modified Synthetic Research Peptide
CJC-1295 No DAC does not contain the Drug Affinity Complex modification found in CJC-1295 DAC formulations. Its C-terminal amidation and modified amino-acid features form part of its complete molecular identity.
Component 2 — Ipamorelin
CAS #: 170851-70-4
Molecular Formula: C₃₈H₄₉N₉O₅
Molecular Weight: Approximately 711.85 g/mol
Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH₂
Length: 5 residues
Product Type: Modified Synthetic Research Pentapeptide
Ipamorelin contains non-standard and D-configured residues together with C-terminal amidation. These structural features should be retained in analytical and technical documentation.
Research Applications
CJC-1295 No DAC + IPA may be examined in controlled non-clinical research involving:
Multi-peptide analytical characterization
Component identity verification
Ligand-receptor interaction studies
Molecular signaling research
Structure-function analysis
Modified peptide comparison
Blend stability assessment
Chromatographic profiling
Non-clinical biochemical and cellular models
Experimental observations should remain specific to the applicable research system and should not be interpreted as evidence of hormonal benefit, performance enhancement, therapeutic effectiveness, or clinical suitability.
Blend Identification
Relevant analytical characterization may include:
CJC-1295 No DAC identity confirmation
No-DAC status verification
Ipamorelin identity confirmation
Component-ratio assessment
Molecular-mass analysis
Modified-residue verification
C-terminal amidation confirmation
Chromatographic purity testing
Lot-specific quality analysis
Specifications & Documentation
Lot-specific documentation should be reviewed for:
CJC-1295 No DAC identity
Ipamorelin identity
Amount of each component
Blend ratio
Individual CAS references
Individual molecular formulas
Individual molecular weights
Peptide sequences
Modified residues
Terminal modifications
Salt or counter-ion forms
Purity specifications
Analytical testing
Lot or batch information
Certificate of Analysis
Storage requirements
Authenticated product-specific documentation should take precedence over generalized blend specifications.
Storage & Handling
Store according to the conditions specified on the product label and Certificate of Analysis. Protect the material from environmental conditions that could compromise peptide integrity.
Handling should follow established laboratory procedures appropriate for multi-component modified research peptide materials.
Research Use Only
CJC-1295 No DAC + IPA is supplied exclusively for laboratory research, analytical testing, and scientific reference purposes.
Disclaimer
**For research use only. Not for human or veterinary use. Not intended for consumption, administration, hormonal use, performance enhancement, diagnosis, treatment, mitigation, cure
